PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna15383.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 224aa    MW: 25813.1 Da    PI: 9.0954
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna15383.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.31e-191663148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT+eEd++l+++++ +G++ Wk++a + g++R++k+c++rw +yl
  mrna15383.1-v1.0-hybrid 16 RGSWTAEEDQRLAQVIEVYGPRKWKSVATKAGLNRCGKSCRLRWMNYL 63
                             89********************************************97 PP

2Myb_DNA-binding50.54.7e-1669114148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  mrna15383.1-v1.0-hybrid  69 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 114
                              78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.0691167IPR017930Myb domain
SuperFamilySSF466891.76E-2914110IPR009057Homeodomain-like
SMARTSM007171.9E-151565IPR001005SANT/Myb domain
PfamPF002492.8E-181663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-241770IPR009057Homeodomain-like
CDDcd001676.45E-111863No hitNo description
PROSITE profilePS5129420.91868118IPR017930Myb domain
SMARTSM007171.9E-1568116IPR001005SANT/Myb domain
PfamPF002492.0E-1469114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2571119IPR009057Homeodomain-like
CDDcd001672.50E-1073114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MVPLSTRSSK SKEVNRGSWT AEEDQRLAQV IEVYGPRKWK SVATKAGLNR CGKSCRLRWM  60
NYLRPNIKRG NISDQEEDLI LRLHKLLGNR WSLIAGRLPG RTDNEIKNYW NSHLSKKIKH  120
NERLQQQNRL LSEPSNPAAK ELLFSSDPQN VELMENNSVS IGIEDTSNSK RQENYFFKSM  180
SFNGSFGDEF LFDGSSAEEG PLNLEWMNRF LEMDESWFTL HGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-311311824128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285440.0FR828544.1 Rosa rugosa mRNA for putative MYB transcription factor (myb11 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004303466.11e-165PREDICTED: transcription factor MYB114-like
SwissprotQ962766e-53MYB23_ARATH; Transcription factor MYB23
TrEMBLF2QKW41e-146F2QKW4_R
STRINGPOPTR_0006s23780.15e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.14e-54myb domain protein 23